El uso de los biomarcadores de inflamación en la vía aérea en el manejo del asma

El uso de los biomarcadores de inflamación en la vía aérea en el manejo del asma

Revista de Patología Respiratoria. 2012;15(4):129-135 REVISTA DE PATOLOGÍA RESPIRATORIA REVISTA DE Órgano de Difusión de la Sociedad Madrileña de N...

309KB Sizes 3 Downloads 74 Views

Revista de Patología Respiratoria. 2012;15(4):129-135 REVISTA DE

PATOLOGÍA RESPIRATORIA

REVISTA DE

Órgano de Difusión de la Sociedad Madrileña de Neumología y Cirugía Torácica VOLUMEN 15 Ȉ NÚMERO 4 Ȉ OTUREǧDIIEMRE ͖͔1͖

PATOLOGÍA RESPIRATORIA

S

U

M

A

R

I

ISSN: 1576-9895

O

EDITORIALES 97 Genotipo y dependencia nicotínica M. Barrueco Ferrero y R. González Sarmiento 101 Importancia para una revista científica de encontrarse incluida en las grandes bases de datos internacionales A. Alonso Arroyo y R. Aleixandre Benavent ORIGINALES 104 Análisis de la proteína C reactiva en la población fumadora sana y con EPOC e influencia de las comorbilidades y del tiempo de abandono del tabaco M.C. Villa-Corbatón, L. Callol-Sánchez, J. Medina-Font, J. Gómez de Terreros-Sánchez, C. Gutiérrez-Ortega y J. Gómez de Terreros-Caro 111 El uso de roflumilast en el tratamiento de la enfermedad pulmonar obstructiva crónica: la perspectiva del neumólogo M. Calle 123 Tratamiento del tabaquismo en la enfermedad pulmonar obstructiva crónica S. Solano Reina, P. Vaquero Lozano, R. Solano Garcia-Tenorio, T. López Ruiz, C.A. Jiménez Ruiz y J.I. de Granda Orive

REVISIÓN 129 El uso de los biomarcadores de inflamación en la vía aérea en el manejo del asma S. Sánchez-Cuéllar y J. Ancochea Bermúdez NOTAS CLÍNICAS 136 Experiencia inicial en el diagnóstico de patologías distintas al carcinoma broncogénico por ecobroncoscopia R. García Luján, L. Comeche Casanova, M.I. Verdugo Cartas, E. de Miguel Poch, A. Acevedo y J.M. Echave Sustaeta 140 Resolución de múltiples nódulos pulmonares cavitados con el abandono del hábito tabáquico como único tratamiento M.L. Estévez, C. Pinedo, M. Rodríguez Masi, I. Guerassimova , P. Benedetti, B. Cabeza y G. Rodríguez Trigo SELECCIÓN BIBLIOGRÁFICA 145 Selección bibliográfica: tabaquismo S. Solano-Reina, J.I. de Granda-Orive, C.A. Jiménez-Ruiz, Á. Ramos Pinedo, S. Flores Martín y Grupo de Tabaquismo de Neumomadrid

www.elsevier.es/pr Incluida en el IME y en el IBECS Scopus y Science Direct

www.elsevier.es/pr

REVISIÓN

(OXVRGHORVELRPDUFDGRUHVGHLQÁDPDFLyQHQODYtDDpUHD en el manejo del asma 66iQFKH]&XpOODU \-$QFRFKHD%HUP~GH] Servicio de Neumología, Hospital Universitario de La Princesa, Madrid, España Instituto de Investigación Sanitaria Princesa (IP). Madrid, España Recibido el 17 de mayo de 2012; aceptado el 22 de junio de 2012

3$/$%5$6&/$9( Asma; ,QÁDPDFLyQ Biomarcadores de la vía aérea

5HVXPHQ /RVPDUFDGRUHVELROyJLFRVHVWiQVLHQGRXVDGRVHQHOGLDJQyVWLFR\WUDWDPLHQWRGH enfermedades tan prevalentes como las cardiovasculares o el cáncer. Los biomarcadores son PX\~WLOHVHQODSUiFWLFDFOtQLFDKDELWXDOFRPRPpWRGRQRLQYDVLYRSDUDHOGLDJQyVWLFRPiVSUHFLVRGHODVHQIHUPHGDGHVSDUDODPRQLWRUL]DFLyQGHODVPLVPDV\SDUDFUHDUSRVLEOHVUHJtPHQHV de tratamiento personalizados. El asma es una enfermedad heterogénea con diferentes fenotiSRV/RVWHVWGHIXQFLyQSXOPRQDUDPHQXGRFRQÀUPDQHOGLDJQyVWLFRSHURQRUHÁHMDQHOSURFHVRSDWROyJLFRUHVSRQVDEOHGHORVGLIHUHQWHVIHQRWLSRVTXHSUHVHQWDODHQIHUPHGDG/RV corticosteroides inhalados junto a los agonistas beta adrenérgicos han sido la piedra angular del tratamiento del asma en los últimos 30 años, pero la heterogeneidad de la enfermedad hace TXHQRWRGRVORVDVPiWLFRVUHVSRQGDQDOPLVPRWUDWDPLHQWR/RVELRPDUFDGRUHVVRQXQDKHUUDPLHQWD~WLOSDUDLGHQWLÀFDUHVWRVIHQRWLSRVHVSHFtÀFRV(VWDUHYLVLyQVHFHQWUDHQODXWLOLGDGGH ORVELRPDUFDGRUHVGHLQÁDPDFLyQGHODYtDDpUHDHQHOPDQHMRGHORVSDFLHQWHVDVPiWLFRVREWHnidos por técnicas no invasivas como es el esputo, el aire exhalado o el suero.

.(<:25'6 Asthma; ,QÁDPPDWLRQ Airway Biomarkers

7KHXVHRIELRPDUNHUVRILQÁDPPDWLRQLQWKHDLUZD\LQWKHPDQDJHPHQWRIDVWKPD $EVWUDFW Biological markers are being used in the diagnosis and treatment of disease as prevalent as cardiovascular or cancer. Biomarkers are a useful in clinical practice as a non invasive methods for the accurate diagnosis of the disease, monitor disease and create personalized treatment regimes. Asthma is a heterogeneous disease with different phenotypes. Pulmonary function test are most often used to confirm the diagnosis, but not reflect the pathological processes responsible for different phenotypes that present the disease. Inhaled corticosteroids and beta 2 agonists have been mainstay of asthma therapy for over 30 years, but the heterogeneity of the disease means not all asthmatics respond to the same treatment. %LRPDUNHUVDUHXVHIXOWRROVWRLGHQWLI\WKHVHVSHFLÀFSKHQRW\SHV7KLVUHYLHZIRFXVHVRQWKH XWLOLW\RIELRPDUNHUVRILQÁDPPDWLRQRIWKHDLUZD\LQWKHPDQDJHPHQWRIDVWKPDSDWLHQWV REWDLQHGE\QRQLQYDVLYHWHFQLTXHVLQFOXGLQJVSXWXPH[KDOHGEUHDWKRUVHUXP

*Autor para correspondencia. Correo electrónico: [email protected] (S. Sánchez-Cuéllar).

130

S. Sánchez-Cuéllar, J. Ancochea Bermúdez

,QWURGXFFLyQ

0DUFDGRUHVGHLQÁDPDFLyQHQHODVPD

(O,QVWLWXWR1DFLRQDOGHOD6DOXGGHÀQHELRPDUFDGRUFRPR ´XQDFDUDFWHUtVWLFDTXHHVREMHWLYDPHQWHPHGLGD\HYDOXDGDFRPRXQLQGLFDGRUGHSURFHVRVELROyJLFRVQRUPDOHV SURFHVRVSDWRJpQLFRVRUHVSXHVWDIDUPDFROyJLFDDXQDLQWHUYHQFLyQWHUDSpXWLFDµ1. /DVFDUDFWHUtVWLFDVTXHGHEHWHQHUXQPDUFDGRULGHDOVH enumeran en la tabla 1. Son necesarios rigurosos procesos GHYDOLGDFLyQELROyJLFD\FOtQLFDDQWHVGHTXHXQELRPDUFDGRUSXHGDVHUDSUREDGRSDUDVXXWLOL]DFLyQHQODSUiFWLFD FOtQLFD6LQHPEDUJRPiVDOOiGHODVFXHVWLRQHVPHWRGROyJLFDV OtPLWHVGHGHWHFFLyQSUHFLVLyQ\UHSURGXFLELOLGDG  H[LVWHQDVSHFWRVWpFQLFRVHVSHFtÀFRVGHOWUDFWRUHVSLUDWRULR TXHDxDGHQGLÀFXOWDGDOGHVDUUROORGHXQPDUFDGRU$GLIHrencia de la orina o la sangre, las muestras de aire exhalado RODVVHFUHFLRQHVGHODYtDDpUHDUHTXLHUHQXQDHVWDQGDUL]DFLyQ\DTXHIDFWRUHVFRPRODFRQWDPLQDFLyQRURIDUtQJHDHO HVSDFLRPXHUWRRHOÁXMRHVSLUDWRULRDIHFWDQDODPXHVWUD Recientes avances han proporcionado una desconcertante YDULHGDGGHFRPSXHVWRVPHGLEOHVTXHHVWiQUHODFLRQDGRV FRQODÀVLRSDWRORJtDGHODHQIHUPHGDGGHODVYtDVDpUHDV 6LQHPEDUJRODWUDQVLFLyQGHOODERUDWRULRDODSUiFWLFDFOtQLFDHVXQFDPLQRODUJR\GLÀFXOWRVR\HQRFDVLRQHVFRQHVcaso rendimiento.

(ODVPDHVXQDHQIHUPHGDGLQÁDPDWRULDGHODYtDDpUHD\ GLFKDLQÁDPDFLyQHVUHVSRQVDEOHHQSDUWHGHORVVtQWRPDV GHOQ~PHURGHH[DFHUEDFLRQHVTXHSUHVHQWDQORVSDFLHQWHV y de otros aspectos relacionados con la actividad de la enIHUPHGDG/DPD\RUtDGHORVELRPDUFDGRUHVTXHH[LVWHQHQ HODVPDUHÁHMDQODLQÁDPDFLyQTXHVHGHVDUUROODHQODYtD DpUHDGHHVWRVSDFLHQWHVSHURODLQÁDPDFLyQQRHVHO~QLFR FRPSRQHQWHSDWROyJLFRGHODHQIHUPHGDG/DUHPRGHODFLyQ de la vía aérea desempeña un papel más importante en la patogenia del asma y, así, los biomarcadores diseñados para indicar cambios estructurales, tales como el daño epitelial, ODKLSHUSODVLDGHODPXFRVDODSUROLIHUDFLyQGHORVPLRÀEUREODVWRVRHOFUHFLPLHQWRGHOP~VFXOROLVRTXHH[LVWHHQHO DVPDWDPELpQSRGUtDQUHVXOWDU~WLOHVSDUDGHÀQLUXQIHQRWLSRHVSHFtÀFRGHODHQIHUPHGDG El asma está empezando a ser considerado como un síndrome overlap, con otras patologías y fenotipos contribuyendo a una importante heterogeneidad en las manifesWDFLRQHVFOtQLFDVHQODSURJUHVLyQGHODHQIHUPHGDG\HQOD respuesta al tratamiento. La espirometría es incapaz de discernir entre los distintos subtipos de enfermedad y discriPLQDUTXpLQGLYLGXRVUHVSRQGHUiQDORVUHJtPHQHVGH WUDWDPLHQWRKDELWXDOHV/DFDUDFWHUL]DFLyQGHORVIHQRWLSRV del asma y el reconocimiento de estos se asocian con una importante variabilidad en respuesta a las nuevas terapias, ORTXHKDLPSXOVDGRODE~VTXHGDGHPDUFDGRUHVHQHODVPD Sin embargo, el papel de los biomarcadores es incierto, pero deberán utilizarse como prueba complementaria a los PpWRGRVGHGLDJQyVWLFRFOtQLFRDVtFRPRHQODPRQLWRUL]DFLyQGHODHQIHUPHGDG Las recomendaciones actuales para valorar el control del DVPDQRLQFOX\HQPHGLGDVGHLQÁDPDFLyQGHODYtDDpUHDSHUR la necesidad de un método no invasivo, validado para medir GLFKDLQÁDPDFLyQHVYLWDOSDUDHOHVWXGLRGHODVHQIHUPHGDGHV UHVSLUDWRULDVLQÁDPDWRULDVWDQSUHYDOHQWHVFRPRHVHODVPDR ODHQIHUPHGDGSXOPRQDUREVWUXFWLYDFUyQLFD (32&  /DELRSVLDEURQTXLDOHOODYDGREURQFRDOYHRODU /%$ \HO FHSLOODGREURQTXLDOVRQKHUUDPLHQWDV~WLOHVSDUDPHGLUODLQÁDPDFLyQTXHH[LVWHHQODYtDDpUHDSHURGHIRUPDLQYDVLYD En la actualidad, existen técnicas no invasivas, como el espuWRLQGXFLGRHOFRQGHQVDGRGHDLUHH[KDODGR\ODQDUL]HOHFWUyQLFDTXHSXHGHQDSRUWDULQIRUPDFLyQLPSRUWDQWH\SUHFLVD sobre la vía aérea en pacientes asmáticos y pueden ser futuros PDUFDGRUHVGHLQÁDPDFLyQ/DVYHQWDMDV\GHVYHQWDMDVGHODV técnicas no invasivas se describen en la tabla 2, y el resumen GHORVELRPDUFDGRUHVPiVXWLOL]DGRVSDUDPHGLUODLQÁDPDFLyQ en el asma en la tabla 3.

Tabla 1 Características de un marcador ideal (QUHODFLyQDVXPHGLFLyQ (todas las siguientes características VHUHTXLHUHQHQWRGRVORVELRPDUFDGRUHV 1. Mínimamente invasiva 2. Fácilmente medible 3. Reproducible (QUHODFLyQDVXDSOLFDFLyQFOtQLFD (todas las siguientes características QRVHUHTXLHUHQHQWRGRVORVELRPDUFDGRUHV   ,QGLFDXQSURFHVRFODYHÀVLRSDWROyJLFRHQUHODFLyQ con la enfermedad, ya sea como un mediador SDWyJHQRRFRPRXQHSLIHQyPHQR   3XHGHVHUXWLOL]DGRSDUDFRQÀUPDUXQGLDJQyVWLFR RLGHQWLÀFDUXQIHQRWLSRFOtQLFRHVSHFtÀFR 6. Puede ser usado para predecir futuros resultados o efectos adversos   3XHGHVHUXWLOL]DGRSDUDLGHQWLÀFDUXQIHQRWLSR de respuesta al tratamiento   3XHGHGHPRVWUDUXQDUHODFLyQGRVLVUHVSXHVWD y por tanto ser utilizado como guía de tratamiento 9. Ser sensible a cambios en la actividad de ODHQIHUPHGDGPHGLDGDSRUXQDLQWHUYHQFLyQ en el tratamiento  6HUVHQVLEOHHQXQSOD]RGHWLHPSRTXHSUHFHGH a cambios en el estado clínico y permite una LQWHUYHQFLyQSUHYHQWLYD 11. Ser sensible a cambios en la actividad de la enfermedad

(VSXWRLQGXFLGR En 1980, Hargreave y sus colaboradores fueron pioneros en ODXWLOL]DFLyQGHOUHFXHQWRGHORVHRVLQyÀORVHQODPXHVWUD de esputo, como posible medida indirecta de la inflamaFLyQGHODYtDDpUHDHQSDFLHQWHVDVPiWLFRV2. La European Respiratory Society (ERS) ha elaborado un documento con UHFRPHQGDFLRQHVSDUDODHVWDQGDUL]DFLyQGHODLQGXFFLyQ FROHFFLyQSURFHVDPLHQWR\DQiOLVLVGHOHVSXWRLQGXFLGR3. En las muestras de esputo se puede obtener dos fases tras el procesamiento y el centrifugado de la muestra: una fase

(OXVRGHORVELRPDUFDGRUHVGHLQÁDPDFLyQHQODYtDDpUHDHQHOPDQHMRGHODVPD

131

Tabla 2 9HQWDMDV\GHVYHQWDMDVGHWpFQLFDVQRLQYDVLYDVTXHPLGHQORVELRPDUFDGRUHVGHLQÁDPDFLyQHQHODVPD Esputo inducido

Condensado Aire exhalado

1DUL]HOHFWUyQLFD

• No invasivo • 0HGLFLyQGHP~OWLSOHV biomarcadores • Permite medidas seriadas • Potente herramienta SDUDHOGLDJQyVWLFR\ HYDOXDFLyQGHWHUDSLD DQWLLQÁDPDWRULD

• No invasivo y portátil • Casi en tiempo real • $OWDGLPHQVLyQGHODVHxDO del biomarcador • Permite medidas seriadas • Potente herramienta para HOGLDJQyVWLFR\ HYDOXDFLyQGHWHUDSLD DQWLLQÁDPDWRULD

• 0HGLFLyQGHP~OWLSOHV

• • • • • •

• Marcadores solubles sujetos DGLOXFLyQ • No es posible repetir en un periodo corto de tiempo • Se precisa experiencia y pericia por un especialista • 6HQHFHVLWDPHGLFDFLyQGH rescate al realizar la técnica • Está contraindicada en asma SHUVLVWHQWHVHYHUR(32& trastornos cardiovasculares activos

• Los ensayos de • (TXLSRFDUR GHWHFFLyQQRVRQ • Muchos factores totalmente perturbadores reproducibles • Se precisa de un muestreo • Caro y alto consumo longitudinal dentro de un de tiempo en el mismo paciente para tener procedimiento PiVLQIRUPDFLyQTXHODTXH • Marcadores solubles aporta una sola medida VXMHWRVDGLOXFLyQ • Se precisa de laboratorio especializado

V biomarcadores E • Recuento celular diferencial N en citospin reproducible 7 • Herramienta válida para A HOGLDJQyVWLFR HMDVPD J UHIUDFWDULD RHYDOXDFLyQ A GHWHUDSLDDQWLLQÁDPDWRULD S D E S V E N 7 A J A S

)UDFFLyQH[KDODGD GHy[LGRQtWULFR No invasivo Reproducible 0HGLFLyQEDUDWD Resultados directos Permite medidas seriadas Herramienta para el GLDJQyVWLFR\HYDOXDFLyQGH ODWHUDSLDDQWLLQÁDPDWRULD en asma

• /DYDOLGDFLyQH[WHUQDQR se ha completado todavía • El programa SPSS se UHTXLHUHSDUDHODQiOLVLV • La tecnología de los sensores está aún en desarrollo

(32&HQIHUPHGDGSXOPRQDUREVWUXFWLYDFUyQLFD

VyOLGDRSHOOHWFRQODVFpOXODVHQWUHOD]DGDVHQWUHHOPRFR \ODIDVHOtTXLGDRVREUHQDGDQWHVLQFpOXODV

%LRPDUFDGRUHVHQODIDVHVyOLGDGHODPXHVWUD GHHVSXWR (OFRQWDMHGHODVFpOXODVLQÁDPDWRULDVHQODVPXHVWUDVGHHVputo se está posicionando como un método complementario muy valioso para la toma de decisiones en el algoritmo del manejo del asma. En 2002, Green y sus colaboradores demosWUDURQTXHFXDQGRDxDGHVHOUHFXHQWRGHHRVLQyÀORVGHOHVSXWRHQHOPDQHMRGHODVPDVREUHWRGRFRQUHODFLyQDODMXVWHGH ODPHGLFDFLyQODIUHFXHQFLD\ODVHYHULGDGGHODVH[DFHUEDFLRQHVGHHVWRVSDFLHQWHVGLVPLQX\HGHIRUPDVLJQLÀFDWLYD4. (VWDWpFQLFDVHKDXWLOL]DGRSDUDLGHQWLÀFDUVXESREODFLRQHVGHDVPiWLFRVTXHGLIHUHQFLDHQWUHDVPDHRVLQRItOLFR\ asma neutrofílico y, por tanto, menos propensos a responder a corticoides5. En pacientes con asma moderada severa, la DXVHQFLDGHHRVLQRÀOLDHQHVSXWRQRGLVWLQJXHHQWUHSDFLHQWHVTXHVXIUHQDVPDQRHRVLQRItOLFR\DVPiWLFRVFX\DHRVLQRÀOLDHVFRQWURODGDSRUHVWHURLGHV8QHVWXGLRUHFLHQWHKD LGHQWLÀFDGRDODSURWHtQDFDWLyQLFDGHOHRVLQyÀORDODSURWHtQDHRVLQRItOLFD\DODSHUR[LGDVDGHOHRVLQyÀORHQPDFUyIDJRVFXOWLYDGRVTXHKDQFRQVXPLGRHRVLQyÀORVDSRSWyWLFRV /DSURWHtQDFDWLyQLFDGHOHRVLQyÀORSHUR[LGDVDGHOHRVLQyÀORSRVLWLYDVDPEDVHQPDFUyIDJRVHVWiQLQFUHPHQWDGDVHQ el esputo de pacientes con asma moderada severa tratada FRQHVWHURLGHVLQKDODGRVHQSDFLHQWHVFRQEURQTXLWLVHRVLQRItOLFD\HQSDFLHQWHVTXHVXIUHQHRVLQRÀOLDWUDVODUHWLUDGD GHORVFRUWLFRLGHV3RUORWDQWRODSURWHtQDGHOHRVLQyÀOR HQHOPDFUyIDJRGHOHVSXWRHVXQPDUFDGRULQGLUHFWRGHOD

HRVLQRÀOLDGHODYtDDpUHDTXHSXHGHLGHQWLÀFDUDVPiWLFRV sometidos a tratamiento con esteroides6. (QFRQFOXVLyQHOUHFXHQWRGHORVHRVLQyÀORV\ORVQHXWUyÀORVHQHODVPDVRQFRQVLGHUDGRVPDUFDGRUHVUHSURGXFLEOHV \YDOLGDGRVSDUDPHGLUODLQÁDPDFLyQGHODYtDDpUHDGHHVtos pacientes y, su número, se relaciona con la severidad de la enfermedad7.

%LRPDUFDGRUHVHQODIDVHOtTXLGD HQODVPXHVWUDVGHHVSXWR (QODDFWXDOLGDGH[LVWHQQXPHURVRVPHGLDGRUHVLQÁDPDWRULRVTXHLQFOX\HQXQDYDULHGDGGHSURWHDVDVFLWRFLQDVTXLPLRFLQDVHLFRVDQRLGHV\TXHSXHGHQVHUPHGLGRVHQHO sobrenadante del esputo. Sin embargo, la validez y reproducibilidad de las distintas técnicas no ha sido todavía estableFLGD$GHPiVGHODSURSLDWpFQLFDGHLQGXFFLyQGHHVSXWR H[LVWHQRWUDVWUHVUD]RQHVTXHSXHGHQDIHFWDUDODPHGLGD GHORVPDUFDGRUHVGHLQÁDPDFLyQHQHOVREUHQDGDQWHGHODV muestras de esputo. /DSULPHUDGHHOODVHVTXHDOSURFHVDUODPXHVWUDVHSXHGHDIHFWDUODPHGLFLyQGHOPDUFDGRU(QODPD\RUtDGHORV SURWRFRORVVHXWLOL]DHOGLWLRWUHLWRO '77 TXHHVDJHQWHUHGXFWRUTXHUHFXSHUDODVFpOXODVGHOHVSXWRDWUDYpVGHOD HVFLVLyQGHORVSXHQWHVGLVXOIXURGHOPRFR8. Sin embargo, el '77DIHFWDDORVSXHQWHVGLVXOIXUR\WDPELpQDODPHGLFLyQ de algunos marcadores, incluyendo a muchas citocinas y TXLPLRFLQDV'LIHUHQWHVJUXSRVGHLQYHVWLJDFLyQKDQUHDOL]DGRPRGLÀFDFLRQHVHQHOSURFHVDPLHQWRGHODPXHVWUDGHHVSXWRSDUDRSWLPL]DUODUHFXSHUDFLyQGHORVPDUFDGRUHV 9.

132

S. Sánchez-Cuéllar, J. Ancochea Bermúdez

Tabla 3 Resumen de los biomarcadores más utilizados SDUDPHGLUODLQÁDPDFLyQHQHODVPD 7pFQLFD Esputo inducido )DVHVyOLGDRSHOOHW • 5HFXHQWRGLIHUHQFLDOGHODVFpOXODVLQÁDPDWRULDV HRVLQyÀORVQHXWUyÀORV • 3URWHtQDFDWLyQLFDGHOHRVLQyÀOR • Proteína eosinofílica • 3HUR[LGDVDGHOHRVLQyÀOR )DVHOtTXLGDRVREUHQDGDQWH • Proteasas • Eicosanoides: — Cisteinil-leucotrienos — 8 isoprostano (el eicosanoide más estudiado en el esputo inducido) Aire exhalado 3HUy[LGRGHKLGUyJHQR Óxido nítrico y sus derivados: • Marcador más estudiado 0HWDEROLWRVGHOiFLGRDUDTXLGyQLFR HLFRVDQRLGHV  • Cisteinil-leucotrienos • 8 isoprostano: es el eicosanoide más estudiado pH: • Marcador mejor medido en el CAE Nariz electrónica Compuestos orgánicos volátiles Proteínas séricas 3URWHtQDFDWLyQLFDGHOHRVLQyÀOR /HSWLQDDGLSRQHFWLQD Quimiocina CCL-17 Proteína YKL-7 IL-6, IL-8

(QVHJXQGROXJDUODVGLIHUHQWHVGLOXFLRQHVTXHVHXWLOL]DQ SDUDFXDQWLÀFDUHOPDUFDGRUSXHGHQDIHFWDUDOUHVXOWDGR En la actualidad no existe ningún factor validado para corregir este problema10. Y por último, algunos marcadores pueden permanecer por GHEDMRGHOOtPLWHGHGHWHFFLyQGHWpFQLFDVDPSOLDPHQWH XWLOL]DGDVSRUORWDQWRVHUHTXLHUHQWpFQLFDVGHGHWHFFLyQ más sensibles11. En el sobrenadante del esputo es posible medir proteasas HQYXHOWDVHQHOSURFHVRGHGHJUDGDFLyQGHODPDWUL]H[WUDcelular. En el asma se han observado incrementos de la metaloproteinasa de la matriz 9 (MMP-9) en el esputo, LBA y ELRSVLDVEURQTXLDOHV12. Diferentes investigadores observan XQGHVHTXLOLEULRHQWUHOD003\HOWHMLGRLQKLELGRUGHODV PHWDORSURWHDVDV 7,03 REVHUYDQGRXQDXPHQWRGHODJUDYHGDGGHODVPDGHSHQGLHQWHGHGLFKDUHODFLyQ13. (QFRQFOXVLyQODUHODFLyQHQWUH0037,03HQHOHVSXWR HVXQSRWHQWHPDUFDGRUGHPRQLWRUL]DFLyQGHORVHIHFWRVGH las intervenciones terapéuticas realizadas en el remodelado de las vías aéreas. /RVHLFRVDQRLGHVHVWiQHQYXHOWRVHQODÀVLRSDWRORJtDGHO DVPDHQHOHVSXWRGHSDFLHQWHVTXHGHVDUUROODQHVWDHQIHU-

medad se aprecian incrementos de los cisteinil-leucotrienos &\V/7V FRUUHODFLRQiQGRVHFRQODVHYHULGDGGHODVPDVLQ verse afectados por los corticosteroides14. El 8 isoprostano es el eicosanoide más estudiado y sus niveles se han observado en el esputo de pacientes con asma y sujetos sanos, apreciándose un incremento de sus valores en los asmáticos más severos y en las exacerbaciones15. La técnica de esputo inducido está bien estandarizada, SHURWLHQHOLPLWDFLRQHVSDUDVXXWLOL]DFLyQHQODSUiFWLFDFOtQLFDKDELWXDO\DTXHHVXQDWpFQLFDODERULRVDTXHUHTXLHUH de personal de laboratorio entrenado, de una infraestructuUDHVSHFtÀFD\ORVUHVXOWDGRVDYHFHVVRQGLItFLOHVGHUHSURducir.

Condensado de aire exhalado El condensado de aire exhalado (CAE) representa un método QRLQYDVLYRTXHSHUPLWHPHGLUXQDDPSOLDYDULHGDGGHPROpFXODVYROiWLOHV\QRYROiWLOHVGHOWUDFWRUHVSLUDWRULRTXH SXHGHQVHUPDUFDGRUHVGHLQÁDPDFLyQ~WLOHVSDUDODPRQLWRUL]DFLyQ\GLDJQyVWLFRGHHQIHUPHGDGHVUHVSLUDWRULDV/RV marcadores en el aire exhalado han sido objeto de numerosos estudios en el pasado, introduciéndose, algunos de ellos en la actualidad, en la práctica clínica habitual. /DPD\RUtDGHORVPDUFDGRUHVGHLQÁDPDFLyQPHGLGRVLQFOX\HQGRODVFLWRFLQDV\ODVTXLPLRFLQDVPXHVWUDQEDMDUHproducibilidad hasta el momento. Por este motivo, los biomarcadores más estudiados en el CAE son los siguientes: el SHUy[LGRGHKLGUyJHQR +222 HOy[LGRQtWULFR\VXVGHULYDGRV ORVPHWDEROLWRVGHOiFLGRDUDTXLGyQLFR HLFRVDQRLGHV \HOS+ Incrementos del H222 en el CAE, marcador de estrés oxidativo de las células inflamatorias, se han observado en diferentes estudios de pacientes con asma más severo, correODFLRQiQGRVHFRQODJUDYHGDGGHODHQIHUPHGDG\ODIXQFLyQ pulmonar16. En pacientes con asma alérgico no controlado, sin tratamiento previo con esteroides, se ha demostrado una FRUUHODFLyQLQYHUVDHQWUH)(9OD3&GHODKLVWDPLQD\HO H222 en el CAE. En pacientes con similares características, la WHUDSLDDQWLLQÁDPDWRULDFRQFRUWLFRLGHVLQKDODGRVUHGXFHHO H222 en el CAE con incrementos en el FEV117. Los eicosanoides se pueden medir en el CAE y niveles elevados de los cisteinil-leucotrienos se observan en el CAE de SDFLHQWHVDVPiWLFRV$OLJXDOTXHRFXUUHFRQHOHVSXWRVXV niveles se correlacionan con la severidad de la enfermedad18\VHUHGXFHQFRQWHUDSLDDQWLLQÁDPDWRULD19. El 8 isoSURVWDQRHVHOSURVWDQRLGHPiVHVWXGLDGRHQHO&$(\DTXH es estable, y detectado tanto en pacientes asmáticos, como en sujetos sanos. En el asma los niveles de 8 isoprostano se correlacionan con la gravedad de la enfermedad, pero sus niveles no se inhiben completamente con el tratamiento corticosteroideo y, por tanto, puede ser un indicador potenFLDOSDUDPHGLUODLQÁDPDFLyQGHODVYtDVDpUHDVDSHVDUGHO WUDWDPLHQWRDQWLLQÁDPDWRULR20. Datos recientes sugieren una UHODFLyQHQWUHODFRQFHQWUDFLyQGHOLVRSURVWDQRHQHO&$( \ODLQÁDPDFLyQGHODYtDDpUHDSHTXHxD21. +DVWDODIHFKDQRKD\XQDHVWDQGDUL]DFLyQFRPSOHWDGHOD recogida de las muestras del CAE y de su posterior análisis, SRUORTXHHVWRGLÀFXOWDVXDSOLFDELOLGDGHQODSUiFWLFDFOtQLca habitual. (Oy[LGRQtWULFRH[KDODGRHVHOPiVHVWXGLDGRKDVWDODIHcha, con un incremento de su valor en pacientes con asma

(OXVRGHORVELRPDUFDGRUHVGHLQÁDPDFLyQHQODYtDDpUHDHQHOPDQHMRGHODVPD

VLQHVWHURLGHVFRUUHODFLRQiQGRVHFRQODHRVLQRÀOLDTXHH[LVWHHQODYtDDpUHD6HKDSURSXHVWRFRPRPDUFDGRUTXH PLGHODLQÁDPDFLyQGHODYtDDpUHDUHTXLULHQGRPHQRVH[SHULHQFLDTXHHOUHFXHQWRFHOXODUHQHOHVSXWR6HKDXWLOL]DGR para optimizar el tratamiento en pacientes con asma, ya TXHSXHGHVHUDSOLFDGRFRPRXQPDUFDGRUQRLQYDVLYRTXH indica probable respuesta a la terapia esteroidea22 o pérdida de control, sobre todo si se observa un cambio con respecto a mediciones previas238QYDORUGHO)H12PHQRUGHSDUWHVSRUELOOyQ SSE LQGLFDSRFDSUREDELOLGDGGHVXIULUDVPD HRVLQRItOLFR8QYDORUGHO)H12SRUHQFLPDGHSSEVXJLHUHIXHUWHPHQWHHRVLQRÀOLDHQODYtDDpUHD\XQDUHVSXHVWD esteroidea. En los pacientes con asma de control difícil tratados con FRUWLFRLGHVLQKDODGRVHO)H12SXHGHLQGLFDUVLHOSREUHFRQWUROGHODHQIHUPHGDGVHGHEHDODLQÁDPDFLyQQRFRQWURODGD TXHH[LVWHHQODYtDDpUHDRDXQDFDXVDQRLQÁDPDWRULD$ pesar de lo anterior, diferentes estudios controlados randoPL]DGRVKDQFRQFOXLGRTXHHO)H12WLHQHSRFRYDORUSRUVt VRORHQFRPSDUDFLyQFRQORVVtQWRPDVFOtQLFRVSDUDRSWLPL]DUODGRVLVGHHVWHURLGHVTXHVHSUHFLVDQSDUDHOWUDWDPLHQto del asma24(VLPSRUWDQWHVHxDODUTXHFDGDXQRGHORVVHLV ensayos revisados utilizan diferentes valores de corte del )H12TXHYDQGHVGHDSSESDUDGLULJLUODVGHFLVLRQHVGH WUDWDPLHQWRSRUORTXHHVGLItFLOFRPSDUDUORVUHVXOWDGRV GHORVHQVD\RV3RUHOFRQWUDULRHO)H12HVHOPHMRUPDUFDGRUSDUDYDORUDUVLODGRVLVGHFRUWLFRLGHHVVXÀFLHQWHSDUD FRQWURODUODLQÁDPDFLyQTXHH[LVWDHQODYtDDpUHD25. /DYDULDFLyQLQWHULQGLYLGXDOHQHO)H12MXQWRFRQXQDLQKHUHQWHKHWHURJHQHLGDGGHODVPDLQFUHPHQWDODLQHVSHFLÀFLGDGGHODSUXHEDORTXHKDFHDO)H12XQDKHUUDPLHQWD relativamente insensible para guiar la terapia en todos los SDFLHQWHVDVPiWLFRV6LQHPEDUJRORVYDORUHVGHO)H12HQ XQLQGLYLGXRVRQDOWDPHQWHUHSURGXFLEOHVSRUORTXHSXHGH ser más valioso utilizar valores personalizados de corte para cada sujeto, en lugar de utilizar un valor de corte único para todos los pacientes. El pH es considerado el marcador mejor medido en el &$(\DTXHHVWiDPSOLDPHQWHYDOLGDGR\HVXQELRPDUFDGRU reproducible, simple de medir y barato. En un estudio reali]DGRSRU+XQW\VXVFRODERUDGRUHVGHPRVWUDURQTXHHOS+ GHO&$(IXHVLJQLÀFDWLYDPHQWHPiVEDMRHQSDFLHQWHVFRQ XQDFULVLVDVPiWLFDTXHHQSDFLHQWHVFRQDVPDFRQWURODGR\ TXHHOS+GHO&$(VHQRUPDOL]yDOWUDWDUODH[DFHUEDFLyQ26. 6LQHPEDUJRQRHVXQPDUFDGRUHVSHFtÀFRGHDVPD\DTXH VHREVHUYDXQS+GLVPLQXLGRWDPELpQHQSDFLHQWHVFRQÀEURVLVTXtVWLFD(32&IXPDGRUHVRLQIHFFLRQHV3RUORWDQto, se podría considerar como un posible marcador de PRQLWRUL]DFLyQGHODDFWLYLGDGGHODHQIHUPHGDG

1DUL]HOHFWUyQLFD e-nose) El aire exhalado contiene una mezcla compleja de compuestos orgánicos derivados del metabolismo sistémico y local, GHODDFWLYLGDGLQÁDPDWRULD\R[LGDWLYD/RVFRPSXHVWRVRUJiQLFRVYROiWLOHV &29 VHSXHGHQXWLOL]DUSDUDPRQLWRUL]DU enfermedades respiratorias e incluso sistémicas. La técnica es completamente no invasiva y permite un alto rendimienWRGHODQiOLVLVPHWDEyOLFR/DWpFQLFDHVWiQGDUGHGHWHFFLyQ de los componentes moleculares en el aire exhalado es la cromatografía de gases acoplada a la espectrometría de ma-

133

VDV/DQDUL]HOHFWUyQLFDXWLOL]DQDQRVHQVRUHVFRQGLIHUHQWHV VHQVLELOLGDGHVSDUDP~OWLSOHV&29EDVDGDVHQGLVWLQWDVWHFQRORJtDVVHQVRUHVFRORULPpWULFRVVHQVRUHVySWLFRVHWF/D DSOLFDFLyQFOtQLFDGHODQDUL]HOHFWUyQLFDHVWiHPHUJLHQGR junto con un rápido desarrollo instrumental y estadístico. /RVHVWXGLRVWUDQVYHUVDOHVFRQODQDUL]HOHFWUyQLFDKDQGHmostrado poder discriminar entre enfermedades respiratoULDV(VWRVHKDREVHUYDGRHQSDFLHQWHVFRQFiQFHUGHSXOPyQ IUHQWHDVXMHWRVVDQRV\IUHQWHDSDFLHQWHVFRQ(32&27. Los pacientes con asma se pueden diferenciar de los controles VDQRV\GHORVSDFLHQWHVFRQ(32&FRQXQQLYHOGHSUHFLVLyQ de un 80-100%28. Los datos preliminares, usando sets de valiGDFLyQH[WHUQDGHSDFLHQWHVFRQDVPD\(32&HVWiQHPSHzando a ser útiles y muestran datos satisfactorios. Esto VXJLHUHTXHODQDUL]HOHFWUyQLFDSXHGHWHQHUXQSDSHOHQHO GLDJQyVWLFRGLIHUHQFLDOGHODVHQIHUPHGDGHVUHVSLUDWRULDV (QHOFDVRGHODVPDDGHPiVGHVHU~WLOSDUDHOGLDJQyVWLFRSXHGHIDFLOLWDUODLGHQWLÀFDFLyQGHGLIHUHQWHVSDWURQHV GH&29TXHGLVFULPLQHQGHIRUPDUiSLGD\VHQFLOODGLVWLQWRV IHQRWLSRVLQÁDPDWRULRVFHOXODUHVTXHH[LVWHQHQHVWDHQIHUPHGDGSHUPLWLHQGRXQPDQHMRWHUDSpXWLFRPiVySWLPR 3DUDODLPSODQWDFLyQGHÀQLWLYDGHHVWDWpFQLFDHQODSUiFtica clínica habitual se necesitan más estudios con un voluPHQJUDQGHGHFDVRVTXHSHUPLWDQGHWHUPLQDUORVSDWURQHV GH&29PiVHVSHFtÀFRVGHFDGDHQIHUPHGDG

3URWHtQDVVpULFDV Los estudios de biomarcadores en asma tienden a concenWUDUVHHQORVFDPELRVHQODFRPSRVLFLyQGHODLUHH[KDODGR $XQTXHHQSULQFLSLRHODVPDHVXQDHQIHUPHGDGGHODVYtDV DpUHDVKD\HYLGHQFLDVTXHVXJLHUHQTXHH[LVWHXQFRPSRnente sistémico en la enfermedad29. En este caso, los metaEROLWRVHQFLUFXODFLyQSXHGHQVHUFDSDFHVGHDFWXDUFRPR biomarcadores del asma. La recogida de sangre, el aislamiento del suero y su análisis son técnicas altamente estandarizadas, mínimamente invasivas y una fuente ideal de datos reproducibles. Las proteínas en suero han ganado creGLELOLGDGFRPRELRPDUFDGRUHQRWUDVHQIHUPHGDGHVLQÁDPDtorias respiratorias. En el caso del asma, los niveles de la SURWHtQDFDWLyQLFDGHOHRVLQyÀORVHLQFUHPHQWDQHQUHVSXHVta a un estímulo alergénico, y disminuyen después de evitar HODOpUJHQRRFRQODWHUDSLDFRQFRUWLFRVWHURLGHVDXQTXHHQ XQDPHQRUSURSRUFLyQTXHORVHRVLQyÀORVHQHOHVSXWRRHO )H126LQHPEDUJRHQXQHQVD\RUDQGRPL]DGRUHDOL]DGR en pacientes con asma, tratados según el nivel de la proteíQDFDWLyQLFDGHOHRVLQyÀORVHREVHUYyTXHORVVtQWRPDVQR mejoraron si se compara con los pacientes tratados con técQLFDVGHPRQLWRUL]DFLyQWUDGLFLRQDO30. Además, la proteína FDWLyQLFDGHOHRVLQyILORHVXQPDUFDGRULQHVSHFtILFRGH DVPDSXHVWRTXHXQHVWXGLRHQSDFLHQWHVSHGLiWULFRVFRQ ÀEURVLVTXtVWLFD\EURQTXLROLWLVYLUDOKDGHPRVWUDGRODH[LVtencia de esta proteína. 1XPHURVRVHVWXGLRVKDQGHPRVWUDGRXQDDVRFLDFLyQHQWUH HODVPD\ODREHVLGDG(OEDODQFHHQWUHODOHSWLQDDGLSRQHFtina es un importante regulador del metabolismo de la grasa FRUSRUDO\VXUHODFLyQVHDOWHUDHQODREHVLGDG9DULRVHVWXdios han demostrado niveles de leptina y adiponectina en sangre alterados en pacientes obesos y no obesos con asma31. 2WURPDUFDGRUDOWHUDGRHQODFLUFXODFLyQGHORVSDFLHQWHV FRQDVPDHVODTXLPLRFLQD&&/OLEHUDGDSRUODVFpOXODV

134

dendríticas y células epiteliales después del contacto con DOHUJHQRHQYXHOWDHQHOUHFOXWDPLHQWRGHODVFpOXODV7KHQ HOSXOPyQ/RVQLYHOHVGH&&/HQHOHVSXWRHVWiQLQFUHmentados en los pacientes asmáticos32 y también se observan niveles de CCL-17 incrementados en el suero de niños con asma y bajos en niños tratados con corticosteroides33. La proteína YKL-7 también está incrementada en el suero de pacientes adultos con asma y se correlaciona con los niveles de esputo y con varios marcadores clínicos de severidad del asma34. Finalmente, las células epiteliales en el asma liberan vaULDVSURWHLQDVDV\TXLPLRFLQDVLQÁDPDWRULDVFRPROD,/\ OD,/QHFHVDULDVSDUDODDFWLYDFLyQGHODFDVFDGDGHODLQÁDPDFLyQ(VSRVLEOHTXHQLYHOHVGHHVWDVPROpFXODVHQOD FLUFXODFLyQSXHGDQVHUGHD\XGDSDUDDGYHUWLUXQDH[DFHUEDFLyQRLQFOXVRLQGLFDUXQVXEWLSRGHLQÁDPDFLyQSDUWLFXODU en un paciente. Hasta hace años el asma se ha descrito como una enferPHGDGGHODYtDDpUHDSHURHQODDFWXDOLGDGSDUHFHTXH SXGLHUDVHUXQDHQIHUPHGDGVLVWpPLFDFRPRORHVOD(32& SRUORTXHODGHWHUPLQDFLyQGHODVSURWHtQDVVpULFDVHQOD clínica habitual podrían ser útiles como biomarcadores de la enfermedad, pero son necesarios más estudios para implementarlo en la guías de práctica clínica.

&RQÁLFWRGHLQWHUHVHV /RVDXWRUHVGHFODUDQTXHQRWLHQHQQLQJ~QFRQÁLFWRGHLQWHreses.

%LEOLRJUDItD 1. Biomarkers and surrogate endpoints: preferred definitions DQGFRQFHSWXDOIUDPHZRUN&OLQ3KDUPDFRO7KHU   89-95. 2. Gibson PG, Girgis-Gabardo A, Morris MM, Mattoli S, Kay JM, Dolovich J, et al. Cellular characteristics of sputum from SDWLHQWVZLWKDVWKPDDQGFKURQLFEURQFKLWLV7KRUD[ 44(9):693-9. 3. Djukanovic R, Sterk PJ, Fahy JV, Hargreave FE. Standardised methodology of sputum induction and processing. Eur Respir J. Suppl. 2002;37:1s-2s. 4. Green RH, Brightling CE, McKenna S, Hargadon B, Parker D, Bradding P, et al. Asthma exacerbations and sputum eosinophil counts: a randomised controlled trial. Lancet. 2002;360(9347): 1715-21. 5. Green RH, Brightling CE, Woltmann G, Parker D, Wardlaw AJ, Pavord ID. Analysis of induced sputum in adults with asthma: LGHQWLÀFDWLRQRIVXEJURXSZLWKLVRODWHGVSXWXPQHXWURSKLOLD DQGSRRUUHVSRQVHWRLQKDOHGFRUWLFRVWHURLGV7KRUD[ 57(10):875-9.   .XONDUQL16+ROOLQV)6XWFOLIIH$6DXQGHUV56KDK66LGGLTXL S, et al. Eosinophil protein in airway macrophages: a novel bioPDUNHURIHRVLQRSKLOLFLQÁDPPDWLRQLQSDWLHQWVZLWKDVWKPD- Allergy Clin Immunol. 2010;126(1):61-9 e3. 7. Jatakanon A, Lim S, Barnes PJ. Changes in sputum eosinophils predict loss of asthma control. Am J Respir Crit Care Med. 2000; 161(1):64-72.

S. Sánchez-Cuéllar, J. Ancochea Bermúdez 8. Efthimiadis A, Jayaram L, Weston S, Carruthers S, Hargreave FE. Induced sputum: time from expectoration to processing. Eur Respir J. 2002;19(4):706-8. 9. Hadjicharalambous C, Dent G, May RD, Handy RL, Anderson IK, Davies DE, et al. Measurement of eotaxin (CCL11) in induced sputum supernatants: validation and detection in asthma. J Allergy Clin Immunol. 2004;113(4):657-62. 10. Kelly MM, Keatings V, Leigh R, Peterson C, Shute J, Venge P, et DO$QDO\VLVRIÁXLGSKDVHPHGLDWRUV(XU5HVSLU-6XSSO 37:24s-39s.  (ULQ(0-HQNLQV*5.RQ20=DFKDUDVLHZLF]$61LFKROVRQ*& 1HLJKERXU+HWDO2SWLPL]HGGLDO\VLVDQGSURWHDVHLQKLELWLRQ of sputum dithiothreitol supernatants. Am J Respir Crit Care Med. 2008;177(2):132-41. 12. Ko FW, Diba C, Roth M, McKay K, Johnson PR, Salome C, et al. A comparison of airway and serum matrix metalloproteinase-9 activity among normal subjects, asthmatic patients, and patients with asthmatic mucus hypersecretion. Chest. 2005; 127(6):1919-27.  9LJQROD$0 5LFFRERQR / 0LUDEHOOD$ 3URÀWD 0 &KDQH] 3 %HOOLD9HWDO6SXWXPPHWDOORSURWHLQDVHWLVVXHLQKLELWRURI PHWDOORSURWHLQDVHUDWLRFRUUHODWHVZLWKDLUÁRZREVWUXFWLRQLQ asthma and chronic bronchitis. Am J Respir Crit Care Med. 1998;158(6):1945-50. 14. Macfarlane AJ, Dworski R, Sheller JR, Pavord ID, Kay AB, Barnes NC. Sputum cysteinyl leukotrienes increase 24 hours after allergen inhalation in atopic asthmatics. Am J Respir Crit Care Med. 2000;161(5):1553-8.  :RRG/**DUJ0/6LPSVRQ-/0RUL7$&URIW.':DUN3$HW DO,QGXFHGVSXWXPLVRSURVWDQHFRQFHQWUDWLRQVLQLQÁDPPDtory airway diseases. Am J Respir Crit Care Med. 2005;171(5): 426-30.  8HQR7.DWDRND0+LUDQR$,LR.7DQLPRWR<.DQHKLUR$HW DO,QÁDPPDWRU\PDUNHUVLQH[KDOHGEUHDWKFRQGHQVDWHIURP patients with asthma. Respirology. 2008;13(5):654-63. 17. Emelyanov A, Fedoseev G, Abulimity A, Rudinski K, Fedoulov A, Karabanov A, et al. Elevated concentrations of exhaled hydrogen peroxide in asthmatic patients. Chest. 2001;120(4): 1136-9.  &VRPD=.KDULWRQRY6$%DOLQW%%XVK$:LOVRQ10%DUQHV PJ. Increased leukotrienes in exhaled breath condensate in childhood asthma. Am J Respir Crit Care Med. 2002;166(10): 1345-9. 19. Baraldi E, Carraro S, Alinovi R, Pesci A, Ghiro L, Bodini A, et al. Cysteinyl leukotrienes and 8-isoprostane in exhaled breath FRQGHQVDWHRIFKLOGUHQZLWKDVWKPDH[DFHUEDWLRQV7KRUD[ 58(6):505-9. 20. Montuschi P, Barnes PJ, Ciabattoni G. Measurement of 8-isoprostane in exhaled breath condensate. Methods Mol Biol. 2010;594:73-84.  %DWWDJOLD6GHQ+HUWRJ+7LPPHUV0&/D]HURPV639LJQROD AM, Rabe KF, et al. Small airways function and molecular PDUNHUVLQH[KDOHGDLULQPLOGDVWKPD7KRUD[   639-44.  6PLWK$'&RZDQ-2%UDVVHWW.3)LOVHOO60F/DFKODQ&0RQWL Sheehan G, et al. Exhaled nitric oxide: a predictor of steroid response. Am J Respir Crit Care Med. 2005;172(4):453-9.  -RQHV 6/ .LWWHOVRQ - &RZDQ -2 )ODQQHU\ (0 +DQFR[ 5- 0F/DFKODQ&5HWDO7KHSUHGLFWLYHYDOXHRIH[KDOHGQLWULF oxide measurements in assessing changes in asthma control. Am J Respir Crit Care Med. 2001;164(5):738-43.  3HWVN\+/&DWHV&-/L$.\QDVWRQ-$7XUQHU&&KDQJ$% 7DLORUHGLQWHUYHQWLRQVEDVHGRQH[KDOHGQLWULFR[LGHYHUVXV clinical symptoms for asthma in children and adults. Cochrane Database Syst Rev. 2009(4):CD006340.  7D\ORU'51LWULFR[LGHDVDFOLQLFDOJXLGHIRUDVWKPDPDQDJH ment. J Allergy Clin Immunol. 2006;117(2):259-62.

(OXVRGHORVELRPDUFDGRUHVGHLQÁDPDFLyQHQODYtDDpUHDHQHOPDQHMRGHODVPD  +XQW-))DQJ.0DOLN56Q\GHU$0DOKRWUD13ODWWV0LOOV7$HW DO(QGRJHQRXVDLUZD\DFLGLÀFDWLRQ,PSOLFDWLRQVIRUDVWKPDSDWKR physiology. Am J Respir Crit Care Med. 2000;161(3 Pt 1):694-9.  'UDJRQLHUL6$QQHPD-76FKRW5YDQGHU6FKHH036SDQHYHOOR A, Carratu P, et al. An electronic nose in the discrimination of SDWLHQWVZLWKQRQVPDOOFHOOOXQJFDQFHUDQG&23'/XQJ&DQFHU 2009;64(2):166-70. 28. Dragonieri S, Schot R, Mertens BJ, Le Cessie S, Gauw SA, Spanevello A, et al. An electronic nose in the discrimination of patients with asthma and controls. J Allergy Clin Immunol. 2007; 120(4):856-62.  /HVVDUG $ 7XUFRWWH + &RUPLHU < %RXOHW /3 2EHVLW\ DQG DVWKPDDVSHFLÀFSKHQRW\SH"&KHVW    /RZKDJHQ2:HYHU$0/XVXDUGL00RVFDWR*'H%DFNHU:$ *DQGROD/HWDO7KHLQÁDPPDWRU\PDUNHUVHUXPHRVLQRSKLO cationic protein (ECP) compared with PEF as a tool to decide

135

inhaled corticosteroid dose in asthmatic patients. Respir Med. 2002;96(2):95-101.  /HVVDUG$ 6W/DXUHQW - 7XUFRWWH + %RXOHW /3 /HSWLQ DQG adiponectin in obese and non-obese subjects with asthma. Biomarkers. 2011;16(3):271-3.  6HNL\D7